SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G048800.4|PACid:26815056 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Gorai.008G048800.4|PACid:26815056
Domain Number - Region: 28-103
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G048800.4|PACid:26815056
Sequence length 123
Sequence
MAPFSLRSRLQASALSKRRLKSKAKHGRKGMKNMEESFKRLKSEMEEISEEQKNIREGQR
QVKEKFGIIESECEELKRETRLIIQQSARTQVKLALMFRILKAREAGELNTAATLTEMLR
LVS
Download sequence
Identical sequences A0A0D2R9L4
Gorai.008G048800.3|PACid:26815055 Gorai.008G048800.4|PACid:26815056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]