SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.008G134600.3|PACid:26817371 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G134600.3|PACid:26817371
Domain Number 1 Region: 731-942
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.19e-59
Family Helical scaffold and wing domains of SecA 0.0000242
Further Details:      
 
Domain Number 2 Region: 97-267,388-435
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-57
Family Tandem AAA-ATPase domain 0.00000421
Further Details:      
 
Domain Number 3 Region: 436-545,642-725
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.1e-50
Family Tandem AAA-ATPase domain 0.000011
Further Details:      
 
Domain Number 4 Region: 266-388
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 5.89e-43
Family Pre-protein crosslinking domain of SecA 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G134600.3|PACid:26817371
Sequence length 943
Sequence
MATAAPIFDSTLGNHHHSLSVSPFTSNFIFNYRNKTYPSIPHVGSSFLSGKSLRVVQIGA
KTPRLGTRRKKRVGVTASLGGLLGGIFKGNDTGESTRQQYAATVTTVNKLEPTMAALSDT
ELKEKTFALKERASQGESLDSLLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAE
MRTGEGKTLVAILPAYLNALSGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKSAEELVLR
DFNYCIIDEVDSILIDEARTPLIISGTAEKPSDAYYKAAKIAAAFERDVHYTVDEKQKTV
LLSEQGYEDAEEILDVKDLYDPREQWASYLLNAIKAKELFLKDVNYIIRGKEVLIVDEFT
GRVMQGRRWSDGLHQAVEAKEGLPIQNETITLASISYQNFFLQFPKLCGMTGTAATESTE
FESIYKLKVTIVPTNKPMIRKDESDVVFRATNGKWRAVVVEISRMNKTGRPVLVGTTSVE
QSDSLSEQLQQAGIPHEVLNAKPENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGN
AEFMARLKLREMLMPRVVKPAGGVFVSVKKPPPMKTWKVNEKLFPCKLSDKNTKLAEEAV
ELSVNTWGKKSLSELEAEELLSYSCEKGPAQDEVIAKLRSAFLEIVKEYKAYTEEERKQV
VAAGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMR
AFRVEDLPIESKMLTKALDEAQRKVENYFFDIRKQLFEYDEVLNSQRDRVYTERRRALMS
DNLQSLIIEYAELTMDDILEANIGSDAPKESWDLEKLIAKVQQYCYLLNDLTPDLLRSEC
SSYEELQDYLCRRGREAYLQKRDMVEKQAEGLMKEAERFLILSNIDRLWKEHLQALKFVQ
QAVGLRGYAQRDPLIEYKLEGYNLFLDMMAQIRRNVIYSIYQV
Download sequence
Identical sequences A0A0D2SZZ4
Gorai.008G134600.3|PACid:26817371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]