SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.009G093000.1|PACid:26768751 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G093000.1|PACid:26768751
Domain Number 1 Region: 21-98
Classification Level Classification E-value
Superfamily TSP9-like 3.4e-27
Family TSP9-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G093000.1|PACid:26768751
Sequence length 98
Sequence
MASLPIFSFVPSKTRIYATAAAKGAGGGKEEKGLFDWILGNLQKEEQFYETDPILKKVEE
KNGGGSGSGTTSGRKNSVSIPQKKKDNGGFGLGGLFKK
Download sequence
Identical sequences A0A0D2TA37
Gorai.009G093000.1|PACid:26768751 XP_012444277.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]