SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.010G002100.1|PACid:26757484 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.010G002100.1|PACid:26757484
Domain Number 1 Region: 81-156
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 7.72e-33
Family Skp1 dimerisation domain-like 0.0000224
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily POZ domain 4.71e-22
Family BTB/POZ domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.010G002100.1|PACid:26757484
Sequence length 158
Sequence
MASTGRKIILKSSDGENFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEY
CKKHVEASKSEDRSASLDDDLKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA
DMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A0A0D2U3I4
Gorai.010G002100.1|PACid:26757484 XP_012449446.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]