SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.010G160200.1|PACid:26761303 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.010G160200.1|PACid:26761303
Domain Number 1 Region: 222-255
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000589
Family Rho termination factor, N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.010G160200.1|PACid:26761303
Sequence length 259
Sequence
MAAAILSFQSLSRFAPSFPFNKQLKLRKPVLSLTEIADKSAPFSSLKPTLSSITSDGNTK
GSGPKKSSNNAPGSKEIDENEISSSGIKAPKSSSKEEMIALFRRIQSSISKGKPGRAETE
SFSSSEDKSTAESVMDVIRESGMNVKDTRSKKGTKALRWRSSISKKSKVEKKATAETEEF
NLSRPPSNFIKRSPIPHPTAHRTKTPERNNEVVSTDGKGSELANMEKLKLSELKELAKAR
GIKGYSRLRKTELLQLLMS
Download sequence
Identical sequences A0A0D2UDC9
Gorai.010G160200.1|PACid:26761303 XP_012451093.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]