SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.011G089400.5|PACid:26807977 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.011G089400.5|PACid:26807977
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.06e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.7e-26
Family Middle domain of MutM-like DNA repair proteins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.011G089400.5|PACid:26807977
Sequence length 265
Sequence
MPELPEVEAARRAIEENCLGKKIKRAIIANDSKVIEGVSSLDFESALLGKTIVSAHRKGK
NLWLHLDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVKDNDEWPSKYSKFFVELDDGLEL
SFTDKRRFARVRLLKDPTSVPPISELGPDALFEPMTINEFTDSLSKKKIGIKALLLDQSY
ISGIGNWIADEVLYQARIHPLQICSSLSKENCATLHNCIKEVIEKAVEVGADSSQFPSNW
IFHSREKKPGKAFVDGLAPEPICVF
Download sequence
Identical sequences A0A0D2VK44
Gorai.011G089400.5|PACid:26807977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]