SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.012G110300.4|PACid:26828322 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G110300.4|PACid:26828322
Domain Number 1 Region: 108-223
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.88e-16
Family N-utilization substance G protein NusG, N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 289-340
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000642
Family N-utilization substance G protein NusG, C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G110300.4|PACid:26828322
Sequence length 345
Sequence
MKQGLLLWSPCYLSPPSFHSISLKIPSIKHTPRLAPISASLDSTDTQVQLQQQLSARERR
QLRNERRESKSGYSWREEVEERLIKKPKKRYTSWTEELNLDNLAHLGPQWWVVRVSRLRG
LETAEVTARVLARNFPNIEFKIYTPAVQEKKRLKNGSISVKPKPLFPGCVFLRCVLNKEI
HDFIRECDGVGGFVGSKVGNTKRQINKPRPVSVDDMEAIFRQAKVEQEKSDQAFQEEQQG
ENALMSDKMNIEYNVDSNGVTSSVLDTKPKRQTKKKSDTVVNGAKYSKQLVPGSKVRVLS
GNFAEFIGSLKKLNRKTGKATVGFTLFGKETLVDLDVKDVVLETK
Download sequence
Identical sequences A0A0D2VY02
XP_012460204.1.20347 XP_012460205.1.20347 XP_012460206.1.20347 XP_012460207.1.20347 Gorai.012G110300.2|PACid:26828321 Gorai.012G110300.3|PACid:26828324 Gorai.012G110300.4|PACid:26828322 Gorai.012G110300.5|PACid:26828319 Gorai.012G110300.6|PACid:26828323 Gorai.012G110300.7|PACid:26828320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]