SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G107400.5|PACid:26786968 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G107400.5|PACid:26786968
Domain Number 1 Region: 71-295,416-463
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-73
Family Tandem AAA-ATPase domain 0.000000262
Further Details:      
 
Domain Number 2 Region: 465-573,669-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.58e-42
Family Tandem AAA-ATPase domain 0.000032
Further Details:      
 
Domain Number 3 Region: 294-415
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.27e-36
Family Pre-protein crosslinking domain of SecA 0.0000941
Further Details:      
 
Domain Number 4 Region: 775-900,971-1004
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 9.59e-25
Family Helical scaffold and wing domains of SecA 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G107400.5|PACid:26786968
Sequence length 1027
Sequence
MVTALSLLNAPFLTPKPLTQLKTLPSAKPNSPFFFPSSFPSFPNLQQHRFNGQPPIAASL
KEKVGCFKKTLSDFTSLNYWVVRDYYRLVDSVNALEPEIQRLSDEQLAAKTSEFKKRLTQ
GEAVSDIQAEAFAVVREAAKRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAA
YLNALTGDGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLVQKGMTAEERRINYQCDITY
TNNSELGFDYLRDNLAGNNDQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDD
ARYPVAAKVAELLMRGLHYNIELKDNSVELTEEGIALAELALETNDLWDENDPWARFVMN
ALKAKEFYRRDVQYIVRNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVVV
AQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQMPVIEVPTNLPNIRKDLPIQAFATAR
GKWEYVSQEVEYMFRQGRPVLVGTTSVENSEYLSDLLQERNIPHSVLNARPKYAAREAEI
IAQAGRKYAITISTNMAGRGTDIILGGNPKMLAREIIEDSLLSFLTREAPSIEVSDMAIS
RKVFSKVKVGPSSMALLAKAALMAKFVGKSEGKSWTHEEAKSIILESVEMSQLKPLKELQ
KLIDEQSEMYPLGPSIAITYLSVLKDCEVHCTKEGSEVKRLGGLHVIGTSLHESRRIDNQ
LRGRAGRQGDPGSTRFMVSLQDEMFQKFNFDTEWAVKLISKITNDEDIPIEGDAIVKQLL
ALQINAEKYFFNIRKSLVEFDEVLEVQRKHVYDLRQLILTGDDESCSQHIFQYMQAVVDE
IVFGNADPLKHPRYWSLSKLLKEFINIAGKLLDDSFAMISEEDLFQSLKQLHESNSVDVD
NFHLPNLPKPPDGFRGIRRKNSSLKRWLAICSDDSTKNGRYRSTTNLLRKYLGDILIASY
LNIVQESGYDDAYIKEIERAVLVKTLDCFWRDHLVNMNRLSSAVFNLKMLLSSTVKYRCI
LMPVFDR
Download sequence
Identical sequences A0A0D2VDF6
Gorai.013G107400.5|PACid:26786968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]