SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.001G037100.1|PACid:26820510 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.001G037100.1|PACid:26820510
Domain Number 1 Region: 35-211
Classification Level Classification E-value
Superfamily MIR domain 7.19e-56
Family MIR domain 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.001G037100.1|PACid:26820510
Sequence length 220
Sequence
MAMGFLGFALFLFLSLDLDQGSTSSASAASSSSTSQNVEITYGTVLKLMHEKTKFRLHSH
DVPYGSGSGQQSVTGFPNVDDSNSYWIVRPEPDTSAKQGDTIPSGTIIRLQHMRTRKWLH
SHLHASPISGNLEVSCFGGESESDTGDYWRLIIEGSGKTWKQDQKIRLQHVDTGGYLHSH
DKKYARIAGGQQEVCGVREKRADNVWLAAEGVYLPITESK
Download sequence
Identical sequences A0A0D2LRK6
Gorai.001G037100.1|PACid:26820510 XP_012450330.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]