SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.001G093100.5|PACid:26823248 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.001G093100.5|PACid:26823248
Domain Number 1 Region: 902-1097
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000105
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 2 Region: 681-886
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000471
Family Tropomyosin 0.0028
Further Details:      
 
Weak hits

Sequence:  Gorai.001G093100.5|PACid:26823248
Domain Number - Region: 514-602
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0863
Family Myosin rod fragments 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.001G093100.5|PACid:26823248
Sequence length 1200
Sequence
MEGDNLVSSEIPVTKAVEDTEIIADAVKASNGDLPLVEKEETTLDGEFIKVEKEAVEMKD
GSNPANPASNQDNESTIERSLSNPGRELLEAQEKTKELELELERVVGALKLSESENRKLK
DEVVLAKEKLDEVGKKYEELDLNHKKLQEQIIEAEQRYSLQLSNLQEALQAQETKQKELT
EVKEAFDGLNIEIENSRKRMQELEQDLQSSVEEARKFEELHKQSGSHAESETQRALELEK
LLETVKLSAKEMEDQMASLREEVKGLYEKVAENQKVEAALQSTTAELSAAQEELALSKSL
VSDLEQRLSSKEALINELTEELEQKKASESKAMEDISILEITFAATKEDFQAKVSELEDI
KLKLEEEVKARELVEATLKDQEVNVLIAQEELSKVLNEKEALETAIADLNSNAALSKELC
NELEEKLKLSDENFSKTDSLLSQALSNNEELEQKLKSLEELHNESGAAAATATQKNLELE
DILQASNEAAEDAKSKLRELEARFIAAEQRNVELEQQLNLVELKGFESEKELKESSEKIS
ELTNKLGEVMEEKNQLNNQMQEYQEKINQLESALNQSTTQNLELAEELKVALERSAHHED
RANMSHQRSLELEDLFQTSHSKLEGTDKKVNELELLLEAEKYRIQELEEQISNLEKKCGD
AEGESVMYSDKVSKLASELEAFQARTSKLEIALQMANEKEKELTECLNLATDEKKKLEET
SQSSNEKLVEAENLVEILRSDLNLTQQKLESIENDLTAVGLRESEVMEKLKSAEEQLEEH
VRVLEEAKARNSELQSLHETLTRDSELKLQEVTENFNSKDSETKSLFEKLKTFEDQIKVY
EEQVAQAAGQSASSKEELDQSLLKLASLESTNEQLKSKISEFENKALQSSSENELLVQTN
IQLKGRIDELQELLNSALSEKESTDQEIASHMSTIKELSDQHTKASELRAEAESRIVEAE
AQLHEAIEKYSKKESESNDLIEKLNALEVQIKTYKEQAHEASTIAVSRQVEVEETLSKLK
QLESFVEELQTKSAHFEKESGGLAEANFKLTQELAEYESKLGDLEGKLTAALTEKDETAE
QLHISKKAIEDLTQKITSEGQSLQSQISSLMEENNLLNETHQSTKKELQSVISQLEEQLK
NEKENEESLKSEINNLKAEIAESSLLQTHVKELEEQLVTVEAQLKEEVHYSLLIKKDTDL
Download sequence
Identical sequences A0A0D2PWS6
Gorai.001G093100.5|PACid:26823248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]