SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.001G146500.1|PACid:26823217 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.001G146500.1|PACid:26823217
Domain Number 1 Region: 23-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.75e-35
Family Ubiquitin-related 0.000032
Further Details:      
 
Domain Number 2 Region: 127-180
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 6.96e-21
Family Ribosomal protein S27a 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.001G146500.1|PACid:26823217
Sequence length 183
Sequence
MEKIHKALLFEVISHFETLADPPPHIKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK
EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKH
KKKKVKLAVLQFYKVDESGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA
GGD
Download sequence
Identical sequences A0A0D2LS10
Gorai.001G146500.1|PACid:26823217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]