SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.002G110300.1|PACid:26794462 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.002G110300.1|PACid:26794462
Domain Number 1 Region: 10-72
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000118
Family BTB/POZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 104-132
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000275
Family Skp1 dimerisation domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G110300.1|PACid:26794462
Sequence length 141
Sequence
MSVTATETNKITLLTADEEEFVVDEAIAMEFGTVKMYYEDNPDSCDKAIPLPNVRSKYLA
KVIEYYKWHVEHRAKKAPKPVKIKFLQYEEEEDEEAKAFDEALVEYVRKFFGIENDYTPE
EEAELRKQNEWAFEDLDPDDD
Download sequence
Identical sequences A0A0D2R415
Gorai.002G110300.1|PACid:26794462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]