SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.002G265100.1|PACid:26793447 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.002G265100.1|PACid:26793447
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-18
Family Ubiquitin-related 0.0092
Further Details:      
 
Domain Number 2 Region: 124-231
Classification Level Classification E-value
Superfamily BAG domain 0.00000000000000109
Family BAG domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G265100.1|PACid:26793447
Sequence length 279
Sequence
MPGGMLVRGDGDDSNLHHNHEAAATSSAGPMIKIDVAYGSAQHQLFVPSHSTVGELKKQI
AEETGLEPDKQRVLFRGKEKEDDVHLSSAGMKDKSKILVLENPTGKVKKVEEMANVEEKV
EESRARKESKVEEIKETEEMSKAFAAVGRVRKEVDKLSERVAAIEVAVNSGTKIAAEEFD
VSAELLMRELLKLDGIEAEGEAKLQRKAEVGVVRRVQGFHETLDKLKTRNSNPFHDSNKA
ASVTTKWETFDSGMGSSTAPPPQPMSSSTKVTEEWEKFD
Download sequence
Identical sequences A0A0D2MGE0
Gorai.002G265100.1|PACid:26793447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]