SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.002G265100.2|PACid:26793448 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.002G265100.2|PACid:26793448
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-18
Family Ubiquitin-related 0.0092
Further Details:      
 
Domain Number 2 Region: 124-228
Classification Level Classification E-value
Superfamily BAG domain 2.35e-18
Family BAG domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G265100.2|PACid:26793448
Sequence length 276
Sequence
MPGGMLVRGDGDDSNLHHNHEAAATSSAGPMIKIDVAYGSAQHQLFVPSHSTVGELKKQI
AEETGLEPDKQRVLFRGKEKEDDVHLSSAGMKDKSKILVLENPTGKVKKVEEMANVEEKV
EESRARKESKVEEIKETEEMSKAFAAVGRVRKEVDKLSERVAAIEVAVNSGTKIAAEEFD
VSAELLMRELLKLDGIEAEGEAKLQRKAEVRRVQGFHETLDKLKTRNSNPFHDSNKAASV
TTKWETFDSGMGSSTAPPPQPMSSSTKVTEEWEKFD
Download sequence
Identical sequences A0A0D2NTA3
Gorai.002G265100.2|PACid:26793448 XP_012468530.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]