SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.003G007300.1|PACid:26801037 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G007300.1|PACid:26801037
Domain Number 1 Region: 79-154
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 5.1e-33
Family Skp1 dimerisation domain-like 0.0000228
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily POZ domain 1.33e-22
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G007300.1|PACid:26801037
Sequence length 156
Sequence
MSSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY
CKKHVEAPKTDDRSADDELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM
IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences A0A0B0PJ28 A0A0D2REL5 J7FXM2
XP_012469291.1.20347 XP_016692489.1.88148 XP_016732742.1.88148 XP_017614065.1.75545 Gorai.003G007300.1|PACid:26801037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]