SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.003G020700.2|PACid:26800651 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G020700.2|PACid:26800651
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-22
Family B3 DNA binding domain 0.001
Further Details:      
 
Domain Number 2 Region: 158-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000432
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G020700.2|PACid:26800651
Sequence length 334
Sequence
MTRKPKRNPSFFKILIGNFDKKQRIPPAFVKYIFKGNVPTMLTLYSDSGNSWRVRIKVEQ
GSYFFNNGWSKFVKYRDLEIGDFLVFFLVDSSTFDVFIYNRTACAKIIILAAKKQKGRSP
RVSRQIEQTPSHKCTSTSKKPRTVPRAQEVEFVSGVTPKSVSYVMVVKGYNKYYAGIPRC
FTEEAGLGKVSMVMIKGPSGMWPMMTTFSSKQVLLSVGWSKFLHENEIVIGDTLLFEYVP
NTGHLIHVQVVNKDGTGNCGSLAGKRPRDRPREQTELPPSTKYASSYKRTKGVSELILEQ
ASFVVVLKKYHQYSVSVPASFLPKKQAWQRNRAR
Download sequence
Identical sequences A0A0D2NV22
Gorai.003G020700.2|PACid:26800651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]