SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.003G170900.3|PACid:26800218 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G170900.3|PACid:26800218
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily PapD-like 1.36e-43
Family MSP-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G170900.3|PACid:26800218
Sequence length 240
Sequence
MSRGDLLSIHPLELKFPFALRKQISCSLQLSNKTDNYVAFKVKTTNPKKYCVRPNAGVVL
PRSTSDVIVTMQAQKEAPPDMNCRDKFLLQSVKVNDGITAKDITSELFNKEAGHVVEECK
LKVVYLSPPQPPSPVHEGSEEGSSPRGSVSDNGHVNAAEFSTAAKAFNEQLEAQDLSPET
RTHITKLTEEKKSALQQCNKIRHELELLKREGNKSGGGVSFMFVIIIGLLGIFMGYMMKS
Download sequence
Identical sequences A0A0D2RP35
XP_012472002.1.20347 Gorai.003G170900.2|PACid:26800217 Gorai.003G170900.3|PACid:26800218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]