SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G040200.1|PACid:26775523 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G040200.1|PACid:26775523
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-42
Family GABARAP-like 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G040200.1|PACid:26775523
Sequence length 135
Sequence
MAKSSFKIEHDFEKRRAEAARIRVKYPDRIPVIVEKTKGNDIPNIDKKKYLVPADLTVGQ
FVYVIRKRIKLSAEKAIFLFVDNVLPPTGAIMSTIYDEKKDEDGFLYVTYSGENTFVALK
KKKKEIIELCMERYS
Download sequence
Identical sequences A0A0D2QW31 A0A1U8MJT0
Gorai.004G040200.1|PACid:26775523 XP_012473329.1.20347 XP_016725824.1.88148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]