SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G041500.1|PACid:26775636 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G041500.1|PACid:26775636
Domain Number 1 Region: 2221-2512
Classification Level Classification E-value
Superfamily BEACH domain 1.09e-116
Family BEACH domain 0.0000000192
Further Details:      
 
Domain Number 2 Region: 2639-2700,2740-2856,2893-2944
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.5e-26
Family WD40-repeat 0.0054
Further Details:      
 
Domain Number 3 Region: 2101-2211
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-21
Family PreBEACH PH-like domain 0.0031
Further Details:      
 
Domain Number 4 Region: 369-407,437-597
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000989
Family Clostridium neurotoxins, the second last domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G041500.1|PACid:26775636
Sequence length 2969
Sequence
MEEEEEKNFGETNVLSDRVGGSHQGNVNFTTGEEAVLRNDNAVSQGFCSASMIGNKDKSE
HVSLENQAKTAGESHGGQVDTNPSEDLDRDRGSSGGFEEHDSFPMIGTWHDRSNSSPGPA
RHTDYDIRQSSSATCLDSVFYADSGYSPHASPRKAKPKAAMPHVSPELLHLVDSAIMGNP
ESLNKLKNIVAGVETFGSEEDMESIPFLVVDSLIATMGGVESFEEDEDNNPPSVMLNSRA
AIVAGELIPWLPWEGDSDIAMSSRTRMVRGLLVILRACTRNRAMCSMAGLLQVLLRSAEN
IFAQGVGSLEHIKWDGTPLCYCIQHLAGHSLSVIDLRRWFQVITRTLTTIWAPRLMIALE
KAVSGRESRGPARTFEFDGESSGLLGPGESRWPFTNGFSFATWIYIESFADTLNTATAAA
AIAAAAAAKSGKSSAMSAAAAASALAGQGTAHMPCLFSFLSADNKGIEAYFHAQFLVVES
GSAKGEKTSLHFTHAFKPQCWYFIGLEYVCRQGIIGKADSELRLYIDGSLYESHPFEFPR
ISKPLAFSCVGTSPPPAMGGLQRRRRQCPLFAEIGPVYIFKEPIGPERMARIASRGGDML
PSFGNGAGLPWLSTNDHVQRMAWESCLLDAEIGDCLHLLYHPCLLTGWFCRDASPSGSAG
ILRRPAEVLGQVHVATRMRPVEALWALAYGGPMSLLPLAVSKMCQDSLEPEQGSLPLSLA
TAALAAPIFRIISIALHHPGNNEEIRRTRGLEILSRILDYLLQTLSSLGDGKHDGAGDEE
LVAAVVSLCQSQKHNYVLKVQLFSTLLLDLKIWSLCSYGLQKKLLSSLADMVFTQSTVMR
DANAMQMLLDGCRRCYWTISEKDSLDTFSLLDATQRVGEVNALVDELLVVIELLIGAAPP
SLAADDVRCLLGFMVDCPQPNQVARVLHLIYRLVVQPNSTRAQTFASSFMGSGGIETLLV
LLQREVKAGDHNIPETSTKEDESLPVQRSEPEGSQDERSTKERDQISQKDFESLFLDGSS
SLVAASPSVKMERMSSVSEIAFMKNLGGISISISADNARNNVYNVDKNDGIVVGVIGLLA
ALVAHGHLKFGSRESSEMTSSLFGVALSDSGGSMFDDKVSLLFYALQKAFQAAPNRLMTS
NAYTALLGASINASSTEDRLSFYDSGHRFEHLQLLVVLLRSLPYASRSFQSRALQDLLFL
ACSHPENRSSLTKMEEWPEWILEVLIYNYEMDERKQSNSVSFGDIEDLIHNFLIIILEHS
MRQKDGWQDIEATIHCAEWLSIVGGSSTGDQRIRREEYLPIFKRRLLIGLLDFAARELQA
QTQVIAAAAAGVAAEGLSPMEAKAQAENAVQLSIFLVENAIVILMLVEDHLRLQSKLSCA
SRKAEGIVSPLSLVSPLYNYSNSIASTGRESTGRESSEGSDDRRSGNSGGLPLDVLASMA
DANGQISAKAMERLTAAAAAEPYDSVSSAFVSYGSCAMDIAEGWKYRSRLWFGVGFPKTG
EFGAGGSGWELWSAALQKDPNGNWIEFPLVKKSVSMLQALLLDDSGLGGGLGIGGGSGTG
MGGMAAPYQLLDSDQPFLCMLRMVLLSMREDDNGADKMVARNVGIEDGVPEALYHQGENI
MSLDNSDGIAAGNPESALLWSVLSPILNMPISDSKRQRVLVASCVLYSEIWHAVGRDRKL
LRKQYLEAIVPPFIAVLRRWRPLLAGIHELATADGLNPLAVGNPVLAADAPPLETALAMI
SPDWAAAFASPPAAMALAMIAAGASGAETPASPATTQFKRESSMLERKTTKLHTFSSFHK
PPTASNKSSSFPKDKAAAKAAALAAARDLERNSKIGSGRGLCAIAMATSAQRRNASDLER
VKRWNESEAMGVAWMECLQPVDTKSVYGKDFNALSYKFIAVLVASFALARNIQRSEIDRR
TQVDLVARHQLFTGIRAWRKLVLCLIEMKCLFGPAGDQPSQARTLCKLRFMESSSRMRPY
LRRNYTGTAHFDGATNFEDQSDLKNNQQDVISSSTAPILAAEAISTNLLNEDDEQPEHDN
EDNRGYENDQGGKDQPRLYGISGQPLHKMVESTDSQFSNEQDLVPSLSAVAPGYNSSELG
ERIVFELPSSMVRLLKIIRGTFQVTTKKINFIVHNTENNTTMDGLERNSEMRNDQKDHSW
LITSLHQMYSRRYLLRRSALELFMVDRSNFFFDFGSSEARRNAYQAIVQAQPPHLNNIYL
ATQRPEQLLKRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYSSKS
LNLADPSAYRDLSKPVGALNPDRLKKFQERYANFNDPVIPKFHYDSHYSSAGTVLYYLVR
IEPFTTLSIQLQGRNFNHSDRIFSDVAATWNRVLEDMSDVKELVPELFYLPEMLTNEYSI
NFGTTQVGRNLDSVKLPPWAQTPVDFIHKHRMALESEHVSAHLNEWIDLIFGYKQRGREA
ILSNNMFLYITYEGTVDINRISDPVQQCATRNKIAYFGQTPSQLLTVPHMKKMPLSEVLH
LQTIFRNPRAVKPYAVPVPERCNLPASAIHACSDALIIVGTNAPAAHIAQHKWQPNTPDD
QGTPFMFEHGKAIASSAGGALIRMLKMPAGSGSDEEQFPQALAYASSGIRSSSIVSITCD
KEIVTGGHADNSIKLLSSEGAKTLETAFGHCAPVTCLALSPDNNYLVTGSRDTTVLLWRI
HRALTSSSSSTSEATADPGTPTSTTGTLANTFAEKSRKHRIEGPIHVLRGHRNEVICCCV
NSDLGIVVSCGHSSDVLLHSIRKGCLMRRFAGVVADTVCLSSAGIILTWNQSQHVLRTFT
LNGIPVATAKVPSFGGLSCMEISVDGNSALIGMNSSSNGVFNNNQNFSFKNPGVDDSNLE
SEEIEELDIPSPSVCFLDLHALKVLHVLKLGKGQDIAALALDKDNTNLLVSTADKQLIIF
TNPTLSKKMAEKKPKVGREGEAASPRLKS
Download sequence
Identical sequences A0A0D2QYW3
Gorai.004G041500.1|PACid:26775636 XP_012473353.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]