SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G049300.1|PACid:26773940 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G049300.1|PACid:26773940
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-35
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 96-131
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0000000000549
Family Ribosomal protein S27a 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G049300.1|PACid:26773940
Sequence length 131
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVDESGKVQRLRKECPNAECGAGT
FMANHFDRHYC
Download sequence
Identical sequences A0A0D2P6Z9
Gorai.004G049300.1|PACid:26773940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]