SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G158900.4|PACid:26775348 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G158900.4|PACid:26775348
Domain Number 1 Region: 90-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-17
Family Skp1 dimerisation domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 16-80
Classification Level Classification E-value
Superfamily POZ domain 0.0000000011
Family BTB/POZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G158900.4|PACid:26775348
Sequence length 250
Sequence
MSEVDMAVIKPEIMKSYIWLQTVDGSIQQVEQEIAMFCPMICHEVIQKGMGSSKNYAISL
PQQVNPAMLSLILDYCRFHQVPGRSNKERKSFDEKFIRMDTKRLCELTSAADSLQLKPLV
DLTSRALARIIEGKAPEEIREIFHLPDDLTEEEKLEPLKNATDDPRIRLLNRLYAKKRKE
LKEREKLKNVEVDEELVDDRSVDDLLSFINGDDGDSKGIKTSKSKKKNRRRKDLLKSTSA
HEATKNHNKC
Download sequence
Identical sequences A0A0D2PCQ7
Gorai.004G158900.4|PACid:26775348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]