SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G260200.1|PACid:26772484 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G260200.1|PACid:26772484
Domain Number 1 Region: 205-307
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-22
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 9-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-19
Family B3 DNA binding domain 0.0025
Further Details:      
 
Domain Number 3 Region: 408-505
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-19
Family B3 DNA binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G260200.1|PACid:26772484
Sequence length 511
Sequence
MFISSMNHPKTLHFFRIILSQTQKLPLPKRFVSLYGDDLSNTVIVKAPTGPEWKVELMKC
DGEIWLANGWKDFADYFSLKYGNLLIFRYEGHSRFYVFMIFDQTTFEIEYPNGIDNHDVE
LQIPDVEEVGSEDVVEIVNNVSPSRKTTEKTRSSPRKRTRMQGATNAKKSEFRMSSRDGS
KIGPEQAGGGTSAAQRSSASSANHFGSEKPFFVVNIQPSYITAFHANVPFTFARTYFTWK
EADVILKDRDGRTWPIHLKVYNKYHCTSFGRGWKAFAIDNDLRVGDSCAFELLEGPEISF
RVTIFRNPEDSNDRHTSTRGSKIGHGRHKRELNARSQIEYDHSSEDEMIRYSKRNKGSQV
PRRKIKTRDGKFDEAMQNKTSARRAIQRLPSKGTAIARALERVSKLRSAHPLFKVIITTN
FLQRGFPSIPERFCDEHMEQIPEDVTLKYKHKSWRVRMIICSDRAGRFSVGWRAFVQGNK
LKVGDVCVFKMIKKTNIVFEVSIFRDGLTLG
Download sequence
Identical sequences A0A0D2RAX2
XP_012476850.1.20347 Gorai.004G260200.1|PACid:26772484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]