SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G284300.1|PACid:26775723 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G284300.1|PACid:26775723
Domain Number 1 Region: 261-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-18
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 53-191
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000022
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G284300.1|PACid:26775723
Sequence length 589
Sequence
MDHRNGFSDSNEISNNNSTTCCIVPAAATTTSETLVSSEPLNTPDVAALQLLSKNLESLY
ESTDSDYFYSDAKIALSSGREVAVHRCILSARSSVFKTVFSGLKDSGAKFELKELARDYE
IGYDSLVAVLAYLYTGKVKSLPKGVCLCVDDGCSHVGCRPALDFIAEVLYAAFVFQVPEL
IALYQRHLLDIIDWVAVDDILVVLYIANMCGNVCEKLVSKCVEIVVKSDVDIVTLDKALP
QPIVKQIIDSRLELSLDKPENVGFPDKHVRRIHRALESDDVELVRMLLKEGHTNLDEAYA
LHYAVAYCDAKTTTELLDLGLADVNHRNSRGYTVLHVAAMRKEPKIIVSLLTKGARPSDL
TIDGRKALQISKRLTRAADYYKSTEEGKASPKDRLCIEILEQAERRDPLHGEASLSLAIA
GDDLRMKLLYLENRVGLAKLLFPMEAKVVMDIAQVDGTSEFTFATINSNKLNGAQTTVDL
NEAPFRIQEEHLNRLKALSRTVELGKRFFPRCSEVLNKIMDADDLSQLACGGNDTAEERV
VKRQRYMELQDVLSKAFHEDKEEFDRSAISSSSSSKSIVVTRPKGTAHC
Download sequence
Identical sequences A0A0D2PJK6
Gorai.004G284300.1|PACid:26775723 XP_012477254.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]