SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.005G056000.1|PACid:26803577 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.005G056000.1|PACid:26803577
Domain Number 1 Region: 133-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000589
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.005G056000.1|PACid:26803577
Sequence length 243
Sequence
MMELLSLDDFKDTKIDPNWGPFDYLLHVLDVDQQKMQKSQNAPPPPQTLCKQDHKGFKLR
SKFNNSVGLKRKRNLKAVEEEDDGDGDRVAPKLKPKRSKKQEKSVCPIPPPDLPPLFRQL
IVEEMGGRGLVLVIQKTIFFSDINPTASRFSIPFSQVKTHDFLNEAEAKELDDKNSMQVW
LLDPSMRGTSITLNKWVMGSSSLYVLTNTWNPLVKNNQLKKGDMVQLWSFRVNSLLCFAL
VKL
Download sequence
Identical sequences A0A0D2SBF8
XP_012480766.1.20347 Gorai.005G056000.1|PACid:26803577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]