SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.005G105400.4|PACid:26802861 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.005G105400.4|PACid:26802861
Domain Number 1 Region: 420-521
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.75e-24
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 219-321
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-24
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 3 Region: 2-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-23
Family B3 DNA binding domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.005G105400.4|PACid:26802861
Sequence length 533
Sequence
MSKPRRPHFLNVFSSTSSANSLRIPVGFNRNLEGRVSASVLLKGPSGYSWNVKLVQRNDD
LLFDEGWADFVADHSLECGDFLVFRYDGDLVFEVKVFDQSSCEKEVAFHCKCSQAGSVFN
GILGQKRYREEEDVSLDQDCEELLKRIRQSSSESVRDEEHCGRELILATTSCQGLTSCDE
NHDGTILKITGKEDDLNLHGSGCIQMIGEFEEKKVAQSFNSCFPFFVRIMKRFNVSGSYT
LNIPYQFAMEHLPNCKTELVLQNLKGACWTVNSVPTTRVHTSHTLCGGWLSFVRSNEIKA
GDICIFELVHKFEFRVHILRVGQEDLDRQSRKAVLDRSDSTLLKKLVKNTSKVHSKLKKV
QICDNKGSKVLDKWKYGNAAKKSASFVLCSLSRSGTEKQAISGLRMMMTVDEEKAARSFA
SRFPSFVRIMRKFNISGSYTLKIPYKFSKEHLPYCKTQVVLRNLQGKCWTVNSLPDSKGR
AVHTFCGGWMAFVRDNEIKIGDICIFELVNNYEMRVHISGPGRKGLDRQHTSL
Download sequence
Identical sequences A0A0D2PR20
Gorai.005G105400.4|PACid:26802861 XP_012478064.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]