SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.005G158800.3|PACid:26804590 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.005G158800.3|PACid:26804590
Domain Number 1 Region: 187-250
Classification Level Classification E-value
Superfamily PUG domain-like 1.83e-17
Family PUG domain 0.0033
Further Details:      
 
Domain Number 2 Region: 335-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000465
Family UBX domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.005G158800.3|PACid:26804590
Sequence length 474
Sequence
MSEMKDKLKGFMKKVNTQFSSSSSSSGKFKGQGRVLGSSSSSGPVNPILTRPSPIPNPAP
SSSSSNSKPVLPSKPPVSDQNKPSSNSNPEPNHKTGSGFDPYDSFITSSKVSKNGFTLNV
FECPICGASYRSEEEVSIHVETCVNNTNSLDRKGTDDESGSNETALEESRGEVEVRVSSF
LSGKPAEGSIEVVLKLLRNIVKEPGNDKFRKLRMSNPKIREAIGEVAGGVELLEFVGFEL
EEEGGEMWAVMDVPKEEQISVISKAIMLLEPGNMEKFKKSENISPTASPEKEETVESKKI
DRKIRVFFSVPESVAAKIELPDSFYNLSSEELKREAEMRKKKIADSQLLIPKSYKEKQAK
AARRKYRRTIIRIQFPDGVVLQGEFAPWEPTSALYEFVSSALKEPCLEFELLDPVIVKLR
VIPSFPAAGEKGRTLEEEDLVPSALIRFKPVETDSVVFTGLSNELLEISEPLVN
Download sequence
Identical sequences A0A0D2RMC8
Gorai.005G158800.2|PACid:26804591 Gorai.005G158800.3|PACid:26804590 XP_012479004.1.20347 XP_012479005.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]