SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.006G091900.1|PACid:26831063 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.006G091900.1|PACid:26831063
Domain Number 1 Region: 272-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000202
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 54-186
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000118
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.006G091900.1|PACid:26831063
Sequence length 583
Sequence
MANLSEPSSSLSFSSSSHLSNGSITHETSAAAATLEVISLTKLSSSLEHLVSDNSPPFSD
ADVVVEGVSVGVHRCILAVRSKFFKELFDKKNNNNGCVEKEGKPSYNMNEFLPYGKIGLE
AFQVFLSYLYTGKLKASPMEVSTCVDTHCAHDACRPAIDFAVELMYASSIFQIPEMVSLF
QRRLLNFVDKALVEDIIPILVVAFHCQCSQLVSQCVDRVTRSDLDSISIEKELPYEVAES
IRLLRCKPPTEAEDGEAVVVPLREKQIRRIQKALDSDDVELVKLLLTESDVTLDDATALH
YAAAYCDPKVVSEILALRLADVNRRNSRGYTVLHIAAMRKEPSVIMSLLAKGASASELTL
DGRSAFNICQRLTRPKDYHAKTEQGKETNKDRICIDVLEREMRRNPMAGDVSVTSHTMAD
DMHMRLLYLENRVAFARLLFPSEAKLAMDIAHAERTSEFSGLSSKGSNGNLSQVDLNETP
VMQKKRLLARMEALMKTVEMGRRYFPHCSEVLDKFMEDDLPDLFYLERGSLEEQKLKRSR
FRELKDDVQKAFNKDKAEFNRNGLTSSSSSSLKDGGRYKLQKL
Download sequence
Identical sequences A0A0D2NP65 A0A1U8I1K8
XP_012484772.1.20347 XP_016672122.1.88148 Gorai.006G091900.1|PACid:26831063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]