SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.006G153600.1|PACid:26832578 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.006G153600.1|PACid:26832578
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 76-127
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.93e-18
Family Ribosomal protein L40e 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.006G153600.1|PACid:26832578
Sequence length 128
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQ
LRPKKKIK
Download sequence
Identical sequences A0A061EUJ0 A0A067FWD3 A0A068UJB6 A0A0B0P7T3 A0A0D2PK61 A0A0D3BRM6 A0A0D6R2M4 A0A0L9U8H9 A0A0S3RZ61 A0A1J6L023 A0A1R3HDI7 A0A1S3AV41 A0A1S3TNA9 A0A1S3XRD6 A0A1U7X7W2 A0A1U8AU69 A0A1U8E394 A0A1U8G8Z4 A0A1U8NH30 A0A200Q2R7 A0A218X2Y8 A0A251KKW0 A0A2G2WIL4 A0A2G3DAH1 A0A2G5ETU7 A0A2G9GFM2 A0A2H3X472 A0A2I0WT43 A5AZI0 B3TLP6 B8LP57 B9SWD7 D6BR61 F4YF91 I1JQ42 I3T1N0 Q45W78 R0FYL0 V4MAT1 V4S7D9 V7D161 W9R8I7
evm.TU.supercontig_104.97 evm.TU.supercontig_3.141 GSVIVT01033876001 NP_001295699.1.15751 XP_002530306.1.68434 XP_002530340.1.68434 XP_003523336.1.40590 XP_003526741.1.40590 XP_003554448.1.40590 XP_004137208.1.97903 XP_004145956.1.97903 XP_006295234.1.15642 XP_006403788.1.70970 XP_006410789.1.70970 XP_006430158.1.91645 XP_006441206.1.91645 XP_006481744.1.29302 XP_006493171.1.29302 XP_007162922.1.22112 XP_008437646.1.74646 XP_008778063.1.81946 XP_008788944.1.81946 XP_008806099.1.81946 XP_009115957.1.100322 XP_009133066.1.100322 XP_009591639.1.42874 XP_009611807.1.42874 XP_009782560.1.57364 XP_009785771.1.57364 XP_009796884.1.57364 XP_010036664.1.83385 XP_010048686.1.83385 XP_010090891.1.32101 XP_010245724.1.60036 XP_010271616.2.60036 XP_010509505.1.75697 XP_010516825.1.75697 XP_010527444.1.14136 XP_010543797.1.14136 XP_010553389.1.14136 XP_010558020.1.14136 XP_010654111.1.54126 XP_010931116.1.75690 XP_010943781.1.75690 XP_010943822.1.75690 XP_011075913.1.78198 XP_011094277.1.78198 XP_011625942.1.86515 XP_011653323.1.97903 XP_012072999.1.15751 XP_012435088.1.20347 XP_012439954.1.20347 XP_012485785.1.20347 XP_012485786.1.20347 XP_012488621.1.20347 XP_013602260.1.26608 XP_013625956.1.26608 XP_013634027.1.26608 XP_013634862.1.26608 XP_013663132.1.73403 XP_013663268.1.73403 XP_013683587.1.73403 XP_013686654.1.73403 XP_013687374.1.73403 XP_013687804.1.73403 XP_013692353.1.73403 XP_013742139.1.73403 XP_013748454.1.73403 XP_013748455.1.73403 XP_014495259.1.7879 XP_015944658.1.100232 XP_015950575.1.100232 XP_016179671.1.73718 XP_016184091.1.73718 XP_016442439.1.3737 XP_016444799.1.3737 XP_016468352.1.3737 XP_016478166.1.3737 XP_016500340.1.3737 XP_016538254.1.72714 XP_016564296.1.72714 XP_016565183.1.72714 XP_016676984.1.88148 XP_016691410.1.88148 XP_016708706.1.88148 XP_016716792.1.88148 XP_016737263.1.88148 XP_017417309.1.48467 XP_017608430.1.75545 XP_017608582.1.75545 XP_017608650.1.75545 XP_017973265.1.67643 XP_017977940.1.67643 XP_018436908.1.40639 XP_018441409.1.40639 XP_018463246.1.40639 XP_018474609.1.40639 XP_018478513.1.40639 XP_019160578.1.57970 XP_019170259.1.57970 XP_019195614.1.57970 XP_019200164.1.57970 XP_019200323.1.57970 XP_019226424.1.74238 XP_019232296.1.74238 XP_019232408.1.74238 XP_019235878.1.74238 XP_019239433.1.74238 XP_020089777.1.18548 XP_020110117.1.18548 XP_020205964.1.88050 XP_020245614.1.76336 XP_020248182.1.76336 XP_020260382.1.76336 XP_020672295.1.41451 XP_021278732.1.83089 XP_021289311.1.83089 XP_022138179.1.20046 XP_022141071.1.20046 XP_022149439.1.20046 Carubv10024320m|PACid:20902693 Eucgr.K02023.1|PACid:23603520 MA_13101g0020 CGD0016619 CGD0020990 Glyma03g35540.1|PACid:16253433 Glyma04g40980.1|PACid:16257461 Glyma06g13870.1|PACid:16262863 Glyma19g38170.1|PACid:16314175 28629.m000567 30000.m000379 Aquca_004_00207.1|PACid:22029746 Aquca_037_00255.2|PACid:22040682 Cucsa.202380.1|PACid:16968971 Cucsa.273380.1|PACid:16973813 Thhalv10010818m|PACid:20207374 Thhalv10017417m|PACid:20181134 cassava4.1_019120m|PACid:17968168 cassava4.1_019127m|PACid:17991053 cassava4.1_019139m|PACid:17992264 cassava4.1_019149m|PACid:17961077 Gorai.006G153300.1|PACid:26832743 Gorai.006G153600.1|PACid:26832578 Gorai.007G016700.1|PACid:26779444 Gorai.007G368200.1|PACid:26785250 Gorai.008G266000.1|PACid:26818603 Tc03_g021500 Tc05_g009560 clementine0.9_025411m|PACid:19266856 clementine0.9_025428m|PACid:19285295 Achn119991 Achn346291 Lus10008873|PACid:23144212 Phvulv091006316m|PACid:23544019 orange1.1g033048m|PACid:18115582 orange1.1g033059m|PACid:18118094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]