SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.006G214300.1|PACid:26831576 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.006G214300.1|PACid:26831576
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily PapD-like 1.31e-38
Family MSP-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.006G214300.1|PACid:26831576
Sequence length 210
Sequence
MPAGEDNQLISVHPSDLKFIIELGKQSFCDLKVVNNTENHVAFKVKTTSPKKYFVRPNTS
VLQPGDSCLIRVTLQAQREYPPDMQCKDKFLLQSTIVPPNTDVDDLPADTFNKESSKDIR
EFKLKVQYISPSAQGNSGDEGSSDSNSTLQQLKEDRDAAVRQTLHLQQELDLLKRRRQRR
NDPGFSFKFATIVGVIGIIVGLVLNLYLSK
Download sequence
Identical sequences A0A0D2QEG5
Gorai.006G214300.1|PACid:26831576 XP_012486767.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]