SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.007G092900.1|PACid:26783437 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.007G092900.1|PACid:26783437
Domain Number 1 Region: 2221-2512
Classification Level Classification E-value
Superfamily BEACH domain 9.55e-125
Family BEACH domain 0.00000000986
Further Details:      
 
Domain Number 2 Region: 2638-2706,2745-2859,2901-2948
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-28
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 3 Region: 2101-2211
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-22
Family PreBEACH PH-like domain 0.0019
Further Details:      
 
Domain Number 4 Region: 375-413,469-602
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000792
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.007G092900.1|PACid:26783437
Sequence length 2977
Sequence
MEEEEEKKFGETSVKSFDTHEIGAVEDRIGGSHQDNATGGEESILKNNNAVSQEVHSATP
IGDEDQFEPVSLENQDKAAGEFQDDQVDSNRSSSSDYQRQFSVMEYDSSSMSGPRHDSSA
SSPGPERQTDYQIKQSISETGLDSVFYADSRGSPLGSPTTSKPKAAMPNVSPELLHLVDS
AIMGKSEGLDKLKNIVSGAETFESVEDMESIPFLVVDSLIATMGGVESFEENEDDNPPSV
MLNSRAAIVAGELIPWLPWEGDSDILMSARTRMVRGLLVILRACTRNRAMCSTAGLLGVL
LRSAENIFAQDVGSIEPMKWDGTPLCYCIQHLAGHSLSVSDLHRWLQVITKTLTTIWAPR
LMLALEKAVSGKESRGPACTFEFDGESSGLLGPGESRWPFTNGYAFSTWIYIESFADTLN
AATAAAAIAAAAAAKSGKSSAMSAAAAASALAGEGTAHMPRLFSFLSADNQGIEAYFHAQ
FLVVECVSGKGKKASLHFTHAFKPQCWYFIGLEHVCRQGLIGKAESELKLYIDGSLYESR
PFEFPRISKPLAFCCIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGPERMARMAS
RGGDMLPSFGNGAGLPWLATNDHVQKMAEESSLLDAEIGGCIHLLYHPCLLSGRFCPDSS
PSGAAGIIRRPAEVLGHVHVAMRMRPVEALWALAYGGPMSLLPLAVSNVCKDNLELEQGS
LPLSLATAALAAPIFRIISVAIHHPGNSEELCRMSGPEILSRILNYLLQNLSYLCSGKHD
GVGDEELVAAVVSLCQSQKHNHALKVQLFSTLLLDIKIWSLCSYGLQKKLLSSLADMVFT
ESSVMRDANAMQMLFDGCRRCYWTIREKDSLDAFSLNDAMRPMGEVNALVDELLVVIELL
IGASPPSLAADDVRCLLGFMVDCPQPNQVARVLHLIYRLVVQPNTTRAQTFAQAFMGSGG
IETLLVLLQREAKAGDHHIPETSTKTEESLAVERSEPELDTCVPEGSQDEGSLKEKDQIS
QKRDFHGISGLVASSSLKVERVSSVSENAFMKNLGGISLSISADNARNNVYNVDNDDGIV
VGIIGLLGALVAYGHLKFGSRVSSEMTSNLFGGALNDAAGSMFEDKVSILLFALQKAFQA
APNRLMTSNVYTALLGASINASSPEDGLNFYDSGHRFEHLQLLLVLLRSLPYASRSFQSR
ALQDLLFLACSHPENRNSLTKMEEWPEWILEVLISNYEMDARKKSDSASLGDIEDFIHSF
LIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGDQRIRREESLPIFKRRLLGGLMD
FAARELQAQTQVIAAVAAGVAAEGLSPEDAKAETENAAQLSVFLVENAIVILMLVEDHLR
LQSKLSCASCKVDGNKSPLSFASAPNSQSSSAASISRESTEAVDDSRSGNSGGLALDVLA
SMADANGQISATVMERLTAAAAAEPFDSVSSAFVSYGSCAMDLAEGWKYRSRLWYGVGLP
SKPIDIGGGGFGWESWNAALQKDANGNWIELPLVKKSVSMLQALLLDDSGLGGGLGIGGG
SGTGMGGMAALYQLLDSDQPFLCMLRMVLLSMREEDNGEDNMIMRNVGVEDGMSEGLYRG
NIISLDNSGRMAARKPRSALLWSVLSPVLNMPISDSKRQRVLVASCVLYSEVWHAVGRDR
KPLRKQYLEAIVPPFVAVLRRWRPLLAGIHELATADGLNPLNVDDRALAADALPLEAALA
MISPSWAAAFASPPAAMALAMIAAGASGGEIPAPTATQLKRDSSILERKTTKLQHFSSFH
KPLDMPNNSPSLPKDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRHDSDVE
RVKRWNDSEAMAVAWLECLQPVDTKSVYGKDFNALSYKFIAALVASFALARNIQRSEIDR
RAQVDLVARHRLFTGIRAWRKLIHCLLDTSCLFGPLVDQIPSKVFWKLDFMESSSRMRPF
LRRNYTGTDHFGAAADFEEQNDVKKIQEDVISSSNTPILAAEAISTVFVNEDDEHPETDN
VDSRGYVNNQSEEGQQRLSGITEQTLEKSIEPKDTKLASEQNLVQSSTIVAPGYVPSELD
ERILFELPSSMVRPLRVIRGTFQVTSKKINFVVDKTECNISMDGSEDNSEAKNDEKDRSW
LMTSLHQMYSRRYLLRRSALELFMVDRSNFFFDFRSSEGRRNAYRAIVQARPPHLNNIYL
ATQRPEQLLKRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYSSKS
LDLSDPSAFRDLSKPVGALNPERLKKFQERYTSFDDPVIPKFHYGSHYSSAGTVLYYLVR
VEPFTTLSIQLQGGKFDHADRMFSDVGATWNGVLEDMSDVKELVPELFYLPEMLTNENSI
DFGTTQLGGKLDSVKLPSWAQSSVDFIHKHRMALESEHVSAHLHEWIDLIFGYKQRGKEA
ISANNMFFYITYEGTVDIDKISDPVQQRATQDQIAYFGQTPSQLLTAPHMKKIPLSEVLH
LQTIFRNPREVKSYAVPSPDRCNLPAAAIHASSDSVIIVDTDAPAAHIAQHKWQPNTPDG
QGAPFLFQHGKAMTSSAGGALRRMFRGPAAAGSGSVDWHFPQALAFSSSGIRNSSIVSIT
CDKEIITGGHADNSIKLLSSDGAKTIEMAFGHSAPVTCLALSPDSNYLVTGSRDSTVILW
RIHRAFTSRPSSTSEPTAGTGTPTSTSSGTLANTLADKSRKHRIEGPIYVLRGHQREILC
CCVSSDLGVVVSCSHSSDVLLHSIRRGRLMRRFAGVEADAVCLSSEGVILTWNQSQHTLS
TFTLNGVLVARAQLPSLGGVSCMEISVDGENALIGMNSSLGNNGMSNSNQDLSLKKPVAD
NLDLESEETNKSNKLDIPSPSICFLNLHTLKVFHVLELGEGQDITAFALNEDNTNLLVST
ADKQLIIFTDPALSLKVVDQMLKLGWEGEGLSPLIKS
Download sequence
Identical sequences A0A0D2SA23
Gorai.007G092900.1|PACid:26783437 XP_012489801.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]