SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.007G139300.2|PACid:26783275 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.007G139300.2|PACid:26783275
Domain Number 1 Region: 424-647
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000373
Family Tropomyosin 0.00092
Further Details:      
 
Domain Number 2 Region: 221-421
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000719
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  Gorai.007G139300.2|PACid:26783275
Domain Number - Region: 699-802
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00288
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number - Region: 1673-1745
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0706
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 1174-1387
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.007G139300.2|PACid:26783275
Sequence length 1848
Sequence
MATVKRADSKGMYSWWWNSHISRKNSKWLQENLTDMDTKVKQMIKLIEEDADSFARRAEM
YYKKRPELMKLVEEFYRAYRALAERYDHATGVLRQAHQTMAEVFPNQVPMVFADDSPGGF
APEVDPCTPEMTPLVRAYLEPDELQKDSVGISSHAIKRNVAFSEESESPMSRKGLKHFNY
VLGSEESTNHVKFAEGRARKILNFHDVEKKERSLQDDDGSDLRVRVPSESERVSKAEMEI
LTLKNALARLEAEKEAGLLEYQQSLDRLTNLEREVSRAQEDSKGLNERASQAEAEVQTLK
DALTKLQAEREANHVQYQQCLEKINNLENSISHAQKDAGELNERASKAETEAQALKQDLS
RVEAEKEDALARYKQCSETISDLEEKLSNAQESARTMTERAEKAESEVETLKQVVVELTK
DKEAAALQYQQCLETISILENRLRCAQEEAQRLKSEIDDGAAKLKGAEERCSLLERTNQS
LHTEVESLVQKMGDQSQELTEKHKELGRLWASIQEERLRFMEAETAFQTLQHLHSQSQEE
LRSLAMELQNRAQILQDIETRNQNLEDELQRVKEENTGLNKLNLSSAMSIQNLQDEILSL
RETIAKLEAEVELRVDQRNALQQEIYCLKEELNDLNKRHQDMTGQLQSVCLNPENFASTV
KELWDENTELKDVCERERDEKLALLEKLKIMEKLIEKNALLENSLSDLNVELEGVRGRVK
TIEESCQSLLREKSTLAAEKDTLISQLQTATENMEKLSEKNNFLENTLFDANAELEVLRQ
KIRSLENSFLLLGDEKSGLITQREGLISQLDVNQKRLEDLEKRYMGLEEKHVGLEKERES
TLREVEELQKSLEAEMQQHASFVQLSRTRETAMESQIHVLQGESLLRKKEYEEELDKAMN
AHVDIFILQKCAQDLEDKNMSLLLECRKLLEASKLSEKLISELELGNCEKQVEIKALFDQ
ITILRMGLYQMSRTLEIDDIHGCDDKIKQDQLVLDCVFGRLQEMQNSLLKSLDENQRFII
ENSVLIALLGQLKLEAETLAAEKNSVRQELKVQSVQFSELLIRAEKLADMNEVLRSKVVE
VNQREDALQTELISVRGQLLALQRQYQTSLEDNCKVLDEKRSLMKEVLDLGKQKHNLEDE
NHAVICEAISQSNISLILKDIIANNFEEIKYLNDNLGKLKCLNNDLEGKLKMMERKFEDL
QMENSNLKDSMKKLENELVSVRSVGDQLNDEVARGKDLLCQREIALLEVEKMLSASQKET
AQLHKVLEDLQTKFEEVKLIGEDQKRQILKLSGDYDHQIKETESISQANQKLEVELLKLN
EELEESKHREESLSFELQKERIKVEIWETQAAAWFDELQTSAIREVIFEEKAHELGKECK
FLESTRNSTAMEVEELERSVRSLECENGGLKAQLAAYVPAIVSLLDSVTSLESRTLLHPE
LPTDYNEEDPNLGTEFHAENCQPTSEGQIGLVPNGFSDLQGIHMRIKAIEKAVLEMEKLA
MLENLNLNSKLETATRQIEELRYGSSSSGESVRAKRHVSARQEEEELGNGLSNNVNMQRP
TPEISEENEMMTKDIILDQVSECSSYGLSRRGTAAEVDTETLELWETADHDANADLKVSK
AQKMATAPTDYQQIGTVKAGKGRTPSTESLVKELGVDKESSKRFAEPNNNGSKRKILERL
DSDVQKLANLQITVQDLKKKVEIIETGKKGKGIEYGTVKEQLEEAEEAITKLFDVNRKLM
THVEDGSWSFDGKSALEPDENGSVRRRRVSEQARRGSEKIGRLQLEVQKIQFFLLNLDDK
KESKAQTRITERRRRVLLRDYLYGGVKSSQKKKKSPFCACVHPPTNGD
Download sequence
Identical sequences A0A0D2TEM2
XP_012490598.1.20347 XP_012490599.1.20347 Gorai.007G139300.1|PACid:26783276 Gorai.007G139300.2|PACid:26783275 Gorai.007G139300.4|PACid:26783277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]