SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.007G139300.3|PACid:26783278 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.007G139300.3|PACid:26783278
Domain Number 1 Region: 389-612
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000353
Family Tropomyosin 0.00092
Further Details:      
 
Domain Number 2 Region: 185-384
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000177
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  Gorai.007G139300.3|PACid:26783278
Domain Number - Region: 664-769
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00243
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number - Region: 1638-1710
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.068
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 1139-1352
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.007G139300.3|PACid:26783278
Sequence length 1813
Sequence
MDTKVKQMIKLIEEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAERYDHATGVLRQ
AHQTMAEVFPNQVPMVFADDSPGGFAPEVDPCTPEMTPLVRAYLEPDELQKDSVGISSHA
IKRNVAFSEESESPMSRKGLKHFNYVLGSEESTNHVKFAEGRARKILNFHDVEKKERSLQ
DDDGSDLRVRVPSESERVSKAEMEILTLKNALARLEAEKEAGLLEYQQSLDRLTNLEREV
SRAQEDSKGLNERASQAEAEVQTLKDALTKLQAEREANHVQYQQCLEKINNLENSISHAQ
KDAGELNERASKAETEAQALKQDLSRVEAEKEDALARYKQCSETISDLEEKLSNAQESAR
TMTERAEKAESEVETLKQVVVELTKDKEAAALQYQQCLETISILENRLRCAQEEAQRLKS
EIDDGAAKLKGAEERCSLLERTNQSLHTEVESLVQKMGDQSQELTEKHKELGRLWASIQE
ERLRFMEAETAFQTLQHLHSQSQEELRSLAMELQNRAQILQDIETRNQNLEDELQRVKEE
NTGLNKLNLSSAMSIQNLQDEILSLRETIAKLEAEVELRVDQRNALQQEIYCLKEELNDL
NKRHQDMTGQLQSVCLNPENFASTVKELWDENTELKDVCERERDEKLALLEKLKIMEKLI
EKNALLENSLSDLNVELEGVRGRVKTIEESCQSLLREKSTLAAEKDTLISQLQTATENME
KLSEKNNFLENTLFDANAELEVLRQKIRSLENSFLLLGDEKSGLITQREGLISQLDVNQK
RLEDLEKRYMGLEEKHVGLEKERESTLREVEELQKSLEAEMQQHASFVQLSRTRETAMES
QIHVLQGESLLRKKEYEEELDKAMNAHVDIFILQKCAQDLEDKNMSLLLECRKLLEASKL
SEKLISELELGNCEKQVEIKALFDQITILRMGLYQMSRTLEIDDIHGCDDKIKQDQLVLD
CVFGRLQEMQNSLLKSLDENQRFIIENSVLIALLGQLKLEAETLAAEKNSVRQELKVQSV
QFSELLIRAEKLADMNEVLRSKVVEVNQREDALQTELISVRGQLLALQRQYQTSLEDNCK
VLDEKRSLMKEVLDLGKQKHNLEDENHAVICEAISQSNISLILKDIIANNFEEIKYLNDN
LGKLKCLNNDLEGKLKMMERKFEDLQMENSNLKDSMKKLENELVSVRSVGDQLNDEVARG
KDLLCQREIALLEVEKMLSASQKETAQLHKVLEDLQTKFEEVKLIGEDQKRQILKLSGDY
DHQIKETESISQANQKLEVELLKLNEELEESKHREESLSFELQKERIKVEIWETQAAAWF
DELQTSAIREVIFEEKAHELGKECKFLESTRNSTAMEVEELERSVRSLECENGGLKAQLA
AYVPAIVSLLDSVTSLESRTLLHPELPTDYNEEDPNLGTEFHAENCQPTSEGQIGLVPNG
FSDLQGIHMRIKAIEKAVLEMEKLAMLENLNLNSKLETATRQIEELRYGSSSSGESVRAK
RHVSARQEEEELGNGLSNNVNMQRPTPEISEENEMMTKDIILDQVSECSSYGLSRRGTAA
EVDTETLELWETADHDANADLKVSKAQKMATAPTDYQQIGTVKAGKGRTPSTESLVKELG
VDKESSKRFAEPNNNGSKRKILERLDSDVQKLANLQITVQDLKKKVEIIETGKKGKGIEY
GTVKEQLEEAEEAITKLFDVNRKLMTHVEDGSWSFDGKSALEPDENGSVRRRRVSEQARR
GSEKIGRLQLEVQKIQFFLLNLDDKKESKAQTRITERRRRVLLRDYLYGGVKSSQKKKKS
PFCACVHPPTNGD
Download sequence
Identical sequences A0A0D2QSD5
Gorai.007G139300.3|PACid:26783278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]