SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.007G174000.1|PACid:26783981 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.007G174000.1|PACid:26783981
Domain Number 1 Region: 492-756
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000621
Family Tropomyosin 0.00099
Further Details:      
 
Domain Number 2 Region: 679-915
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000582
Family Tropomyosin 0.00096
Further Details:      
 
Weak hits

Sequence:  Gorai.007G174000.1|PACid:26783981
Domain Number - Region: 903-1095
Classification Level Classification E-value
Superfamily Tropomyosin 0.000275
Family Tropomyosin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.007G174000.1|PACid:26783981
Sequence length 1335
Sequence
MEGENLASTEIPVKEALKDTENIAEPVNVGKEGNKDEEETALDGEFIKVEKEALDMKDGS
NVAKPSPNQGDESTTIERSLSNPGRELLEAQEKMKELELELERVTGALKDFESENSRLKD
EALLAKEKLDEVGKQYDELDLSNKKLQEQIIEAEQRYSLELANLKEAFQAQEAKQKELAE
VKEAFDGLNIEIENSRKRMQELEQDLRSSVEEARKLEELQKQSGLHAESEMQRALESERL
LETAKLGAKEMEDQMASLKEEIEGLYEKVAENQKVNAALQSTTAELSAAQEELAISKSLV
LDLEQRLASKEALISELANELDLKKASESKVRENISTLENIFAATKEDLQVKVSELEDIK
LKLEEEVKAREFVENEMKDQEIQLSVVKEELSKVLKEKEALEIDMSDLSSNAARLKESCS
ELEEKLKLSNENFCKTDSLLSQALSNNQELEQKLKSLEELHSESGVAAATATEKNLELED
IIKASNETEEVAKSKLRELEARFIAAEQRNVELEQQLNLVELKGFEAEKELKEFSGKISE
LTTKLGEAEEEKELLNKQMQEYQEKVNLLESALNQSTIKNTELLKELKVSAERSAQHEDR
ANMSHQRSLELEDLFQNSHSKLEGADKKVNELELLLEAEKYRIQELEEQISKLEKECGDT
EAESSRYSDKASELTHELEAFQARASSLEIAVHMANEKEKELTECLNLATDEKKKLEEAS
RGSSEKLAEAENLVEILRDDLNMTQRKLESIENDLKAAGLRESEVMEKLKAAEEELEQHV
KVLEQASARNSELESLHESLSRDSEVKLQELMESFTNKDSEAKSLFEKLKSFEDQIKVYE
EQVAQASGQSATLKEELDQSLKKLASLESTNEQLRKEMLEVENKALQSTSESELLVQTNI
QLKGRVDELQELLNSAVSEKEVTPQEIASHVYTIRELSDQPTKALEHRDQAESRIVEAEA
RLHEAIEKYTKKESEANDLIEKLNVLENQIKTYEEQTHEASEIAVSCEVEAEETLVKLKQ
LESLDEELQTKSSHFEKESGGLAEANLELTEELATCESKLSDLEGKLAAALAEKDETADQ
LHSSKKAIEDLTQQIASEGRRFQSQISSLMEENNLLNKTHQDTKKELQSAILQLQEQLEN
EKEKEQSLILELKNLKDKIAESSGTQTRAKELEEQLVKLETQLKQAVQIAAQRQADHAQD
LGYRDAIDKQKEAEREAALNCCHEELEAKNKETLLLEKKVKELEDKLQVAAKGGGSSAEL
KDGVEVKSKDIDGLTFSAPSKRKSKKKLEAASVQAASSSSTPTNHEVASPLTTLKFIFGV
AFVSVIIGVILGKRY
Download sequence
Identical sequences A0A0D2QUL4
Gorai.007G174000.1|PACid:26783981 XP_012491171.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]