SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G008500.4|PACid:26818151 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G008500.4|PACid:26818151
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-25
Family Ubiquitin-related 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G008500.4|PACid:26818151
Sequence length 119
Sequence
MAEGKELIELKFRIYDGTDIAHSTYASSMTVATLKQKIVAEWPQDKTVIPKSINDLKLIH
AGRVLENNKSLADSRITFGDLPVGVITMHVVVQPTIAKNKTEKSKEDMQKLNSCRCVIL
Download sequence
Identical sequences A0A0D2SY75
XP_012435914.1.20347 XP_012435915.1.20347 XP_012435916.1.20347 Gorai.008G008500.1|PACid:26818149 Gorai.008G008500.2|PACid:26818150 Gorai.008G008500.3|PACid:26818152 Gorai.008G008500.4|PACid:26818151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]