SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.008G149200.10|PACid:26818559 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G149200.10|PACid:26818559
Domain Number 1 Region: 30-164
Classification Level Classification E-value
Superfamily E set domains 0.000007
Family Arrestin/Vps26-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G149200.10|PACid:26818559
Sequence length 508
Sequence
MLPYRFSFFGDGGYSKVGTEDGDISQLNPKLKLQTDRDVYRPGDSIYVTIEICNPLIGDK
TSSTVPSLWVERLGFEIKGIEKLDTQWFAIQKPSTGMKHGRGEHVFLDSSTPSMVSNQIV
NSGSSKNYVVRAMLPSVIPPSYKGTTIRYLYYIKSTMSVPWLLMENGHSSKESVKDLTKV
EARVPFQVWVTEKGNGLVMEDGQSDDIVPSTTIQTDMYWKEIDGDSEWLQARVSDTNDGV
EEGYESSRDEISSVSSYNPLKENLIKSFRSSLSFESTTARSSNRDGPYHDMDYSSLPSNV
GLHRLSVAEVMHDSNTDKSLAVLSQSQQQAPARTLYPDVTGVSSAPTESVASEGFIRGRS
YNIRMDEHVLLRFSPKNSESTYYFSDMIGGTLTFFHEEGARRCLEVQSDHHEVVADLVQT
SFLFSIPMDGPMSFSTPHISVEWALRFEFFTTPKNLDWTRYEHPLLVEGRDKSEWVLPIT
VHAPPSGTSSTLTRTEKPFSLEPLWVHS
Download sequence
Identical sequences A0A0D2T0X1
XP_012438112.1.20347 Gorai.008G149200.10|PACid:26818559 Gorai.008G149200.4|PACid:26818560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]