SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.008G149200.7|PACid:26818567 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G149200.7|PACid:26818567
Domain Number 1 Region: 30-164
Classification Level Classification E-value
Superfamily E set domains 0.00000686
Family Arrestin/Vps26-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G149200.7|PACid:26818567
Sequence length 471
Sequence
MLPYRFSFFGDGGYSKVGTEDGDISQLNPKLKLQTDRDVYRPGDSIYVTIEICNPLIGDK
TSSTVPSLWVERLGFEIKGIEKLDTQWFAIQKPSTGMKHGRGEHVFLDSSTPSMVSNQIV
NSGSSKNYVVRAMLPSVIPPSYKGTTIRYLYYIKSTMSVPWLLMENGHSSKESVKDLTKV
EARVPFQVWVTEKGNGLVMEDGQSDDIVPSTTIQTDMYWKEIDGDSEWARVSDTNDGVEE
GYESSRDEISSVSSYNPLKENLIKSFRSSLSFESTTARSSNRDGPYHDMDYSSLPSNVGL
HRLSVAEVMHDSNTAEGFIRGRSYNIRMDEHVLLRFSPKNSESTYYFSDMIGGTLTFFHE
EGARRCLEVQSDHHEVVADLVQTSFLFSIPMDGPMSFSTPHISVEWALRFEFFTTPKNLD
WTRYEHPLLVEGRDKSEWVLPITVHAPPSGTSSTLTRTEKPFSLEPLWVHS
Download sequence
Identical sequences A0A0D2T6F0
Gorai.008G149200.13|PACid:26818568 Gorai.008G149200.7|PACid:26818567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]