SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.008G149200.8|PACid:26818554 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G149200.8|PACid:26818554
Domain Number 1 Region: 30-164
Classification Level Classification E-value
Superfamily E set domains 0.0000084
Family Arrestin/Vps26-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G149200.8|PACid:26818554
Sequence length 536
Sequence
MLPYRFSFFGDGGYSKVGTEDGDISQLNPKLKLQTDRDVYRPGDSIYVTIEICNPLIGDK
TSSTVPSLWVERLGFEIKGIEKLDTQWFAIQKPSTGMKHGRGEHVFLDSSTPSMVSNQIV
NSGSSKNYVVRAMLPSVIPPSYKGTTIRYLYYIKSTMSVPWLLMENGHSSKESVKDLTKV
EARVPFQVWVTEKGNGLVMEDGQSDDIVPSTTIQTDMYWKEIDGDSEWLQARVSDTNDGV
EEGYESSRDEISSVSSYNPLKENLIKSFRSSLSFESTTARSSNRDGPYHDMDYSSLPSNV
GLHRLSVAEVMHDSNTDKSLAVLSQSQQQAPARTLYPDVTGVSSAPTESVASEGFIRGRS
YNIRMDEHVLLRFSPKNSESTYYFSDMIGGTLTFFHEEGARRCLEVSVTLETSETINRRF
VHPSRRNSPTITKVQSDHHEVVADLVQTSFLFSIPMDGPMSFSTPHISVEWALRFEFFTT
PKNLDWTRYEHPLLVEGRDKSEWVLPITVHAPPSGTSSTLTRTEKPFSLEPLWVHS
Download sequence
Identical sequences A0A0D2T0W8
Gorai.008G149200.2|PACid:26818553 Gorai.008G149200.8|PACid:26818554 XP_012438105.1.20347 XP_012438106.1.20347 XP_012438107.1.20347 XP_012438108.1.20347 XP_012438109.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]