SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.009G183200.1|PACid:26768939 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G183200.1|PACid:26768939
Domain Number 1 Region: 516-867
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.01e-95
Family Hect, E3 ligase catalytic domain 0.00000283
Further Details:      
 
Domain Number 2 Region: 81-169
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.21e-17
Family Ubiquitin-related 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G183200.1|PACid:26768939
Sequence length 881
Sequence
MSLFPSPAVDQFSNGYDHRLSSKRKFDDYALAFDGDQDFEAPLVPVRMRKDDHHHPIAAV
SKAPPFAFPPSHIDCRPSSSDASSSSASCSSTRLQFFVRMFSGGKTMVVTANSEDTVKSL
HERIHVMTGIPVFEQRLIYHGKQLQWEQSLADCHIENDAGLQLVGRMRSTDHPQTWQVMD
DLVSLISSLCRGETVHSPTQSIKGCLDKFFTIAHKDNGKVASADLQIFMVSSAPAALVML
YISPIDGNKQCANSSIRDFLTSCRMDLPKELHSYCAPIALEFCKLLRKVVNEDSLYAWCR
STLSVLLESVSSSMGLMRTKVKGFTVQEIFPFFNELVSHLSEELDSSLYSTTSEGPSSSH
FREFVAFLNPLRSAIIEQVESRIPISIDYHPLYRDEIRNLHLIFDKLLHKMKNCLIRVEE
ILVARGSNGDEFVHSGWSQYLSILKELNGISKLYQGAEEKFWMVLRNMKASLCALIIRFS
RRDDDNQWLLEHKDVTDFESRRHLVMMMFPEVKDDYEELHEMLIDRSQLLAESFEYIARV
DPESLHAGLFMEFKNEEATGPGVLREWFLLVCQAIFNPENALFLPCAYDRRRFFPNPASR
MDPLHLEYFSFAGRVIALALMHKVQVGIVFDRVFFLQLAGMDISLEDIREADPCLYSSCK
KILEMDAEFIDSDALGLTFVREVEELGSRTVVELCAGGKSIVVNSRNRQEYVNLLIRDRF
STSTSEQVDYFSQGFGHILSNSRLQKIFFQSLELEDLDRMLYGSESPICVDDWKAHTEYN
GYKESDPQITWFWEIVREMSADQRKQLLFFWTSVKYLPVEGFRCLASRLYIYKTSEPCDY
LPSSHTCFYRICFPPYPSMGEMRKRLNVITQEHIRCSFGTW
Download sequence
Identical sequences A0A0D2TRY8
XP_012445467.1.20347 Gorai.009G183200.1|PACid:26768939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]