SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.009G399000.3|PACid:26767050 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G399000.3|PACid:26767050
Domain Number 1 Region: 81-185
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-30
Family B3 DNA binding domain 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G399000.3|PACid:26767050
Sequence length 241
Sequence
MEPTQTPPSSKLHNPSSISLENSPWTSHFYPSMFLSSIHAPRHFNLNHDDDEELDDQTST
LNTLNPKPNPPENHQLGHETEPMFEKPLTPSDVGKLNRLVIPKQHAEKYFPLGGDSSDKG
LLLSFEDESGKCWRFRYSYWNSSQSYVLTKGWSRYVKEKQLDAGDIILFQRHRTDGDRLF
IGWRRRGAAVVVAPAATDGGNAMMENDSGGGGGGNGGWNNRGLYQRYPHLGHIQGWCGYL
E
Download sequence
Identical sequences A0A0D2TZE7
Gorai.009G399000.3|PACid:26767050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]