SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.009G426900.5|PACid:26764117 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G426900.5|PACid:26764117
Domain Number 1 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.91e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.95e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.95e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 4 Region: 456-532
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.06e-33
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 5 Region: 304-380
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.37e-33
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 6 Region: 380-456
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.37e-33
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 7 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.32e-33
Family Ubiquitin-related 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G426900.5|PACid:26764117
Sequence length 533
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF
Download sequence
Identical sequences A0A022PTU0 A0A067EPU8 A0A0D2U0U6 A0A1U8A3N7 A0A1U8E826 F1SY21 G7LI77 I1KLN6 V4USD0
XP_003627151.1.50012 XP_006452186.1.91645 XP_006583831.1.40590 XP_009618236.1.42874 XP_009618237.1.42874 XP_009618238.1.42874 XP_010256344.1.60036 XP_012443537.1.20347 XP_012443538.1.20347 XP_012827477.1.32330 XP_016543362.1.72714 orange1.1g009480m|PACid:18110233 orange1.1g009518m|PACid:18110232 clementine0.9_007111m|PACid:19283076 Medtr8g018230.1 mgv1a004313m|PACid:17676676 mgv1a004316m|PACid:17676677 Gorai.009G426900.1|PACid:26764118 Gorai.009G426900.2|PACid:26764116 Gorai.009G426900.3|PACid:26764115 Gorai.009G426900.5|PACid:26764117 Glyma07g32020.1|PACid:16268449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]