SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.010G186800.1|PACid:26756543 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.010G186800.1|PACid:26756543
Domain Number 1 Region: 541-893
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-98
Family Hect, E3 ligase catalytic domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 113-199
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.21e-17
Family Ubiquitin-related 0.002
Further Details:      
 
Weak hits

Sequence:  Gorai.010G186800.1|PACid:26756543
Domain Number - Region: 193-231,260-365
Classification Level Classification E-value
Superfamily ARM repeat 0.000561
Family HspBP1 domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.010G186800.1|PACid:26756543
Sequence length 906
Sequence
MCSPPPQQAGGFHRPMSLFQSAAVDQLSNGYDHRLSSKRKFDDYAFSFDEEDPLVPVRMR
KDDHTHQGASPITAVHHSSKAPASSFPASLVNSLPSSSDVPSSSSSCSSSRLQFFIRMIS
EGNTIVVQANSEDTVKSLHERIQVMTGIPVMEQRLIYRGKQLQWEQSLADCSIQNDAGLQ
LVGRMRSTDHPQTWQVMDDMISVICRLCRGETPSSPTKHIKDCLTNFFTIAPKDNNDSGP
AHLQIFMASSAPAALVMLYMSPIKKNKMCADDSIRHILTQYRSALPKHLHSYCAPILLEF
CKLLRKVVNEDSLYEACRSALGMLLESVGTSRGLMLPEVKGLIVIQDIFPFVSELADKIS
KNLESSVDSTSSGEPLSSDVRDFTAFLNPLRSTILERVAFRIPISVKWKKKDNSNPSYGE
AVEFLHTIFNDLLGKMENCLIRVEENLTATGSSEGEYLSSEWSQYLAILKELNGISKLYQ
GAEEQFWMLLRNRKSSLCALIIRFAKRNEDNRWLLEHKDVTDFESRRHLAMMMFPEVKED
YEELHEMLIDRSQLLSESFEYIAHADPESLHAGLFMEFKNEEATGPGVLREWFFLVCQAI
FNPENALFVPCSNDRRRFFPNPASRVDPLHLEYFRFAGRVIALALMHKVQVGVVFDRVFF
QQLAGMHISLEDIRETDPCLYSSCKKILEMDAEFIDSDALGLTFVREVEELGSRRLVELV
AGGKNIVVNSKNRQEYVNLLIRDRFVTSISEQVDHFSQGFGHILSNSRLQKFFFQSLELE
DLDWMLYGSESPICIEDWKAHTEYNGYTENDPQITWFWEIVREMSAEQRKVLLFFWTSLK
HLPVEGFRGLASQLYIYKSSEPHERLPSSHTCFYRLCFPPYTSRAEMQKRLNVVTQEHVG
CSFGTW
Download sequence
Identical sequences A0A0D2UH00
XP_012448557.1.20347 Gorai.010G186800.1|PACid:26756543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]