SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.011G016600.3|PACid:26808889 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.011G016600.3|PACid:26808889
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.25e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 76-145
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.49e-29
Family Ubiquitin-related 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.011G016600.3|PACid:26808889
Sequence length 160
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKENRLFIWFYVFEVGCRSSSRL
Download sequence
Identical sequences A0A0D2T0K8
Gorai.011G016600.3|PACid:26808889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]