SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.011G050200.1|PACid:26809527 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.011G050200.1|PACid:26809527
Domain Number 1 Region: 271-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-16
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 61-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000738
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.011G050200.1|PACid:26809527
Sequence length 587
Sequence
MAYLSEPSSSLSFSSSSHLSNGSITHNIPPFSVPETGANLEALSLTKLSSSLEQLIVDNC
PVFSDADIVVEGVAVGVHRCILAVRSKFFNEVFKEGSGSSEKDGKPSYNMSELLPYGKIG
LEAFQVFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAISFAVELMYASSIFQIPELVP
LFQRRLLNFVEKALLEDIIPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYEVT
ESIRLLRRKSPSDGEGNEAVVDPLQEKRIRRIHKALDSDDVELVKLLLTESDITLDDATA
LHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASASTL
TFDGQSAVNICRRLTRPKDYHAKTEQGKETNKDRICIDILEREMRRNPMAGDVSVASHAL
SDDLHMRLLYLENRVALARLLFPSEAKLAIDIAHAETTSELATGFPSKCSNGNLRQVDLN
ETPIMQKQRLLARMQALMKTVEMGRRYFPHCSEVLDKFMEDDLPDLSYLETGTPEEQRIE
RSRFRELKEDVQRAFKKDKAEFNRNGLSSSSSSSSFRDGGPYKYRKL
Download sequence
Identical sequences A0A0D2VIA6
Gorai.011G050200.1|PACid:26809527 XP_012455608.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]