SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.011G050200.4|PACid:26809530 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.011G050200.4|PACid:26809530
Domain Number 1 Region: 271-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-16
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 58-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000479
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.011G050200.4|PACid:26809530
Sequence length 465
Sequence
MAYLSEPSSSLSFSSSSHLSNGSITHNIPPFSVPETGANLEALSLTKLSSSLEQLIVDNC
PVFSDADIVVEGVAVGVHRCILAVRSKFFNEVFKEGSGSSEKDGKPSYNMSELLPYGKIG
LEAFQVFLSYLYTGKLKPSPMEVSTCVDNVCAHDACRPAISFAVELMYASSIFQIPELVP
LFQRRLLNFVEKALLEDIIPILVVAFHCQCSQLVSQCVDRVARSDLDSICIEKELPYEVT
ESIRLLRRKSPSDGEGNEAVVDPLQEKRIRRIHKALDSDDVELVKLLLTESDITLDDATA
LHYAAAYCDPKVVSEVLGLRLADVNLRNSRGYTVLHIAAMRKEPSVIMALLAKGASASTL
TFDGQSAVNICRRLTRPKDYHAKTEQGKETNKDRICIDILEREMRRNPMAGDVSVASHAL
SDDLHMRLLYLENRGITLFGGFHVALSNWFVILHFPAFHLCCRTS
Download sequence
Identical sequences A0A0D2RH16
Gorai.011G050200.4|PACid:26809530 Gorai.011G050200.5|PACid:26809531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]