SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.011G176700.1|PACid:26806975 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.011G176700.1|PACid:26806975
Domain Number 1 Region: 236-311
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-21
Family Ubiquitin-related 0.00071
Further Details:      
 
Domain Number 2 Region: 92-166
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-16
Family Ubiquitin-related 0.004
Further Details:      
 
Domain Number 3 Region: 11-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000171
Family Ubiquitin-related 0.0019
Further Details:      
 
Domain Number 4 Region: 162-236
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000142
Family Ubiquitin-related 0.0031
Further Details:      
 
Domain Number 5 Region: 323-376
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000248
Family Ubiquitin-related 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.011G176700.1|PACid:26806975
Sequence length 378
Sequence
MKPSAAERPHVGSSEEEIPVYLKLVKTVAWKVKPTETVKDLKALLYEKGIVSETIRDLCF
AGKLLTDDERLVDHGIQRNSTLHLLLQNFDVVKLHIKIPSEQRTIIVEARANDTVESIKS
LIEVTEGIQLNRFSLIYEGKLLEEDWSLSSLDVKNESTICVVFSQTDVLSIYVKALSGKV
AKLKVKVTFSVADVKAIADTMLGTSAGSLFYLGQQLEDSKILACYDIKEESMLQILHPLF
QVFVKTWSGRTLTLDVQQNMTVQDVKDKIFKKLKIPVHLQSIIFSGKRLEGGRDLASYRI
QKHSTLSMVLAPSSTIMRIEVGKITSSISHFSTVRTVKEMIRSKKGITVKEILYGEKALD
DEFSLEHYGINKETELTV
Download sequence
Identical sequences A0A0D2UV75
Gorai.011G176700.1|PACid:26806975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]