SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.011G215000.2|PACid:26810644 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.011G215000.2|PACid:26810644
Domain Number 1 Region: 36-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000278
Family Ubiquitin-related 0.009
Further Details:      
 
Domain Number 2 Region: 120-194
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000303
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.011G215000.2|PACid:26810644
Sequence length 201
Sequence
MDMKKMVQITLYNQEKEEKRILLKLNRVGCGDEADQYCYSISPSIPLLDLMLDFIKRVGV
TFNSVRFYYEDKPINPALNAIWLNMKDGDTIAVSRRRNFRPTAATQSTLITLPLAVVGEK
PVVLKVKHFRADGALYYYLIGRNTPMKNLLHDYADRINDLYEQVNLSCFRFCSIDMGKTA
DDLGLKDGDVIYAFLFAMRAC
Download sequence
Identical sequences A0A0D2RQX6
Gorai.011G215000.1|PACid:26810643 Gorai.011G215000.2|PACid:26810644 Gorai.011G215000.3|PACid:26810645 XP_012457647.1.20347 XP_012457648.1.20347 XP_012457649.1.20347 XP_012457650.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]