SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.012G038400.2|PACid:26825718 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G038400.2|PACid:26825718
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.49e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 79-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-27
Family Ubiquitin-related 0.0000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G038400.2|PACid:26825718
Sequence length 154
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGTMIKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQRLI
YAGKQLADDKTARDYNIEGGSVLHLVLALRGGCL
Download sequence
Identical sequences A0A0B0N165 A0A0D2VV36 A0A1U8MF41
XP_012460488.1.20347 XP_016725462.1.88148 XP_016725491.1.88148 XP_016751378.1.88148 Gorai.012G038400.1|PACid:26825719 Gorai.012G038400.2|PACid:26825718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]