SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.012G133500.5|PACid:26828077 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G133500.5|PACid:26828077
Domain Number 1 Region: 34-176
Classification Level Classification E-value
Superfamily E set domains 0.000098
Family Arrestin/Vps26-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G133500.5|PACid:26828077
Sequence length 478
Sequence
MLASRFSFFGGGGSNKVGNSVEGDKKELKELNPTLKLQTDRDVYRPGDSVYVTIEICNPF
TSGNTGAIVPSLLIEKLGFEIKGIEKLDTQWYATQKPAAGTKQRRGEHVFLDCSTPSMIS
NQIVPSGSAKTYVVRAVLPSIIPPSYKGSTIRYIYYIKSALSVRWLILENGHSSKDSVKD
LTEVEARVPLQVWVTQKGNGLVMEDGQSDGIVPATTIQTDIYWKEMDGDSEWARVNDLYD
SIEEGYESSRDEISSVSSFNLSKENLNRTFGSSLSLQSSAARSSFRDGPYYDGDRLSLSS
NVGLPRLSVAEVLHDSSADVSTALLSPSQQQTSTKSLAANDITGVSSAPSPGATEPLASE
GFIRGRSYNIRMDDQVLLRFSPKNSESTYYFSDMIGGTLTFFHEEGARRCLEVSVTLETS
ETISRRFVHPSRRNSPTITKVVIIMRLLLIWYRQVFSFLSPWMVPCHFPLLMSRCSGF
Download sequence
Identical sequences A0A0D2TNY6
Gorai.012G133500.5|PACid:26828077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]