SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G039800.1|PACid:26789744 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G039800.1|PACid:26789744
Domain Number 1 Region: 125-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-24
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G039800.1|PACid:26789744
Sequence length 236
Sequence
MKEIPRSVKQYPFEQLQDNECISPALQNMFGGSKLSNCINWGGDVNRQNPKAVNNQPIRG
SGAMKPEPKKRGRKRKFDPNVQDSSAGREDDADMRLRCYESASARKRTVTAEERERAINA
AKAFEPINPFCRVVLRPSYLYRGCIMYLPSCFAEKHLSGVSDSIKLQLPDGRQWSVRCRY
KGGKAKFSRGWYEFTLENNLGEGDVCVFELLRSREIVLKVTVFRVMESGGLMHRSQ
Download sequence
Identical sequences A0A0B0PYM7 A0A0D2W2K4 A0A1U8IGH7
XP_012462596.1.20347 XP_012462597.1.20347 XP_016674964.1.88148 XP_017619827.1.75545 Gorai.013G039800.1|PACid:26789744 Gorai.013G039800.2|PACid:26789743 Gorai.013G039800.5|PACid:26789742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]