SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G039800.6|PACid:26789747 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G039800.6|PACid:26789747
Domain Number 1 Region: 83-182
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-24
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G039800.6|PACid:26789747
Sequence length 194
Sequence
MHLNLKNSANEVKLRTSGSGAMKPEPKKRGRKRKFDPNVQDSSAGREDDADMRLRCYESA
SARKRTVTAEERERAINAAKAFEPINPFCRVVLRPSYLYRGCIMYLPSCFAEKHLSGVSD
SIKLQLPDGRQWSVRCRYKGGKAKFSRGWYEFTLENNLGEGDVCVFELLRSREIVLKVTV
FRVMESGGLMHRSQ
Download sequence
Identical sequences A0A0D2V8U2
Gorai.013G039800.4|PACid:26789746 Gorai.013G039800.6|PACid:26789747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]